PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 340aa    MW: 38722.5 Da    PI: 8.7068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619430.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
   XP_013619430.1 14 KGLWSPEEDEKLLNYITRHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding506.9e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia +++ gRt++++k++w++
   XP_013619430.1  67 RGAFSQDEESLIIELHAALGNR-WSQIATRLP-GRTDNEIKNFWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.515961IPR017930Myb domain
SuperFamilySSF466893.74E-2912108IPR009057Homeodomain-like
SMARTSM007177.6E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-161461IPR001005SANT/Myb domain
CDDcd001673.89E-111761No hitNo description
PROSITE profilePS5129425.90662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2665116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.1E-1467111IPR001005SANT/Myb domain
CDDcd001673.91E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MRRHSCCYKQ KLRKGLWSPE EDEKLLNYIT RHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEESLIIE LHAALGNRWS QIATRLPGRT DNEIKNFWNS CLKKKLRIKG  120
IDPTTHKPLV SDLQTLNVID QKLTSSTTSE VSKSTGLITN DHDRSMVISS QLGPSWFPEI  180
KTTANQNVAF CFSSITTTPT VLDQMTSNFN PVPNNWELNY CRNTVPSQRN SIYNAFYGNH  240
FTEASQIMNN NNNHVMDPHY HQDMKSWPSE ILHYTEHNQS SETGLKAEVK PDIANYYLGS  300
SSSSSSSLNE SAARLLHNAE VDLYGTNLQK LNNMAFHQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0058891e-173AB005889.1 Arabidopsis thaliana mRNA for ATMYB4, complete cds.
GenBankAY0997771e-173AY099777.1 Arabidopsis thaliana transcription factor ATMYB4 (At5g26655) mRNA, complete cds.
GenBankAY5196291e-173AY519629.1 Arabidopsis thaliana MYB transcription factor (At5g26660) mRNA, complete cds.
GenBankBT0087401e-173BT008740.1 Arabidopsis thaliana At5g26655 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619430.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH60.0MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0D3AXJ40.0A0A0D3AXJ4_BRAOL; Uncharacterized protein
STRINGBra020526.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.10.0myb domain protein 86